SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003215 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003215
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-29
Family C-type lectin domain 0.00000709
Further Details:      
 
Domain Number 2 Region: 213-255
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003215   Gene: ENSMEUG00000003525   Transcript: ENSMEUT00000003530
Sequence length 359
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_141:376:19151:-1 gene:ENSMEUG00000003525 transcript:ENSMEUT00000003530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLFWKYQPHFGNWWGVLKLWVLTVLYCDFLALHGVDCWTYHYSERPMPWAKARTYCQTSY
TDLVAIQNKAEIVYLNATLPLSPTYYWIGIRKVQGVWTWVGTNKSLTAEAENWGKGEPNN
KKSKEDCVEIYIKRKEDAGKWNDDSCLKLKTALCYQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGYFNFSSKCTFHCSEGTSLIGAVESIC
ERSGNWSSPEPVCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSRNILSPIKEGNYNPIFIPLGIVVTCFCGLVFIIWLARKLKK
Download sequence
Identical sequences ENSMEUP00000003215 ENSMEUP00000003215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]