SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003229 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000003229
Domain Number - Region: 193-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.0392
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003229   Gene: ENSMEUG00000003537   Transcript: ENSMEUT00000003544
Sequence length 272
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5937:315:41989:-1 gene:ENSMEUG00000003537 transcript:ENSMEUT00000003544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPALLLALVCLASSSARAWCQLPSDWRPLSESCRAELAEIIVYAKVLALHQEMYSLYNY
LPWQYEAASEGGLFYSAEIEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY
FFFLRMDENYNLLPHGVNFQDAIFPXXXXXXXXXXXXXXXXXXXXXXQPVTFSSDWEIQE
DNRLMCSSVQKALFEEEHHVKKLQQKVASLEKRNKQLRDRVKKVKRSLRQAKKNSRRMEL
MNRKLSEKLASGSIPHINSLKQEHAHASYLKV
Download sequence
Identical sequences ENSMEUP00000003229 ENSMEUP00000003229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]