SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003305 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003305
Domain Number 1 Region: 406-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.0002
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.72e-25
Family BAR domain 0.011
Further Details:      
 
Domain Number 3 Region: 588-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.05e-24
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 285-359,412-435
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-17
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003305   Gene: ENSMEUG00000003612   Transcript: ENSMEUT00000003627
Sequence length 740
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_862:1093:26124:1 gene:ENSMEUG00000003612 transcript:ENSMEUT00000003627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVESDVSELENRLEKLLKLGSSLLESGRNYLATCRAFI
SGIQELSKLGPPEPMMIECLDKFTESLSHKVNCHEDLLNATQQTLKQQIQSFVKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVI
QDKRKFDIMEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRWFTIQNNQLVYQKK
YKDPMTVVVDDLRLCTVKLCPDIERRFCFEVVSPSKSCLLQADSERCFQLWVSAVQSSIA
TAFSQAQEDRGSLDQGPCHSASGLASTLASGGASRGTSRGSSVAGRVAAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARIQEMSVKKPGPTCSRQEKEAWIHAKYVEKKFLTKLPVVKGRKVGRVHPRGQP
PLPPKPQLPPRPGNMGAKPVPPSGEVGCLHPGALLFWAAGPPPSLPTMADALAHGADVNW
VNGAQENATPLIQATSSNSLLACEFLLQNGANVNQADSMGRSPLHHATILGHTGLACLFL
KRGADLGAQDSEGKDPLTIAMETANADIVTLLRLAKMREVEVAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
Download sequence
Identical sequences ENSMEUP00000003305 ENSMEUP00000003305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]