SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003456 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003456
Domain Number 1 Region: 1219-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-36
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1087-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 7.13e-32
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.57e-31
Family Cysteine rich domain 0.00000133
Further Details:      
 
Domain Number 4 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 2.77e-20
Family Fibronectin type II module 0.00051
Further Details:      
 
Domain Number 5 Region: 873-927
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-16
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 6 Region: 931-993
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000186
Family C-type lectin domain 0.0088
Further Details:      
 
Domain Number 7 Region: 420-468
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000332
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 505-545
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000162
Family C-type lectin domain 0.017
Further Details:      
 
Domain Number 9 Region: 1049-1087
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000402
Family C-type lectin domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000003456
Domain Number - Region: 312-342
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000542
Family C-type lectin domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003456   Gene: ENSMEUG00000003774   Transcript: ENSMEUT00000003798
Sequence length 1454
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5746:3046:96663:1 gene:ENSMEUG00000003774 transcript:ENSMEUT00000003798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISLFLVFLSLTYGASQLLDTKQFLIYNDDHKRCVNAVSASAVQTAPCNLETESQKFRW
VSNTQLMSVALKLCLGVPSKNDWVPVTLFPCDSKNDLQKWECKNDTLFGIQGEDLYFNYG
NKQEKNIMLYKGSGLWSRWRVHGTTDDLCSRGYEEMYTLLGNSNGAPCVFPFKFEGKWYA
DCTSAGRSDGWLWCGTTADYESNRLFGFCPLKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSPALEPGKSCVLLNPAKNAKWENVECSQRLGYICKKGNSSLNPFIIPSXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKD
TLWIGLNDLKIQMYFEWSDGTPVTFTKWLPGEPSHANNRQEDCVVMKGKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGWKRYGLYCYLIGQTLSTFAVANQTCINQKAYLA
TVEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWMDGTKVNYVSWAPGEPNFANDDENCV
VLYTSSGLWNDINCGYPNAFICERHNSSINTTASPTPAPLPGGCQGGWKLFQNKCYRFFG
FKIEERKSWQNARKDCQKLGGNLPSIHSSKEQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCVVMVGGTSREAGQWVDEICDNEKGYICQT
DSDPALPHSVTPASEDFTKYGDSSYSVKAMKMKWKDAKAYCEDSSAQIASILDPYVNAYV
WLEMQKHNEPVWIGLNSNLTEGAYVWVDNWRMRYTNWAPGEPQVKSGCVYMDLDGFWKTA
LCNETYQFLCKKSDVKPSTEPPQLPGRCPDTEQTSWIPFHRHCYYIESSSTRSWGQALLE
CSRMGASLVSIESDMESEFLKHKVEPLKSKTNFWLGMFRNVEGNWLWINNNPVSFVNWKS
GEPSSERNEDCVELYSSSGQWNNLYCSSYKGYICKREKIVDVKPTQPMEKPKDEPETIIT
PKTHNSAGIVVVVVLLILTGAGAAAYFFYRKRQVRVPQEANFDNTLYFNTASTPGVSDTK
DLMGNIEQNEHALI
Download sequence
Identical sequences ENSMEUP00000003456 ENSMEUP00000003456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]