SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003729 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003729
Domain Number 1 Region: 3-99,137-262
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.73e-47
Family FCH domain 0.01
Further Details:      
 
Domain Number 2 Region: 413-596
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00044
Further Details:      
 
Domain Number 3 Region: 645-700
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003729   Gene: ENSMEUG00000004079   Transcript: ENSMEUT00000004105
Sequence length 911
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6882:2187:109654:1 gene:ENSMEUG00000004079 transcript:ENSMEUT00000004105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVG
QQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRS
PDSTSNVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFK
YYIHDLSDLIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDK
QRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQSRLSTLKIENEE
VKKTMEATLQTIQDIVTIEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQET
EQFYFTKMNEYLEGRNLIXXXXXXXXXXXXXXXXXQRTDCSLARRSSTIRKQDSSQAIPL
VVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLK
LYFRGLEHPLFPKDIFHDLMACVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
SQFSEENMMDPYNLAICFGPTLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFPSPRELE
GPVYSRGGSMEDYCESPHGETTSAEDSAQDITVDHHTSDDECEPIEAIAKFDYIGRTARE
LSFKKGASLLLYHRASDDWWEGRHNGIDGLIPHQYIVVQDTEDGVAERSSPKSEIEVICE
PPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGNIRKTFRQNEGHGLSSPLLDSS
SGPGGASCRPSSQPIISQSLPKEGSDKCSASGHGGLNSISRHSSLKNRLDSPQIRKTVTA
GRSKSFNNHRPMDPEVIAQDIEATMNSALNELRELERQSNVKHTPDVVLDTLEPLKTSPV
GAPTSEPSSPL
Download sequence
Identical sequences ENSMEUP00000003729 ENSMEUP00000003729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]