SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003770 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003770
Domain Number 1 Region: 1045-1204
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-43
Family C-type lectin domain 0.00000662
Further Details:      
 
Domain Number 2 Region: 148-267
Classification Level Classification E-value
Superfamily C-type lectin-like 9.42e-39
Family Link domain 0.0024
Further Details:      
 
Domain Number 3 Region: 260-360
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-28
Family Link domain 0.0042
Further Details:      
 
Domain Number 4 Region: 1205-1265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000959
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 53-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000223
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003770   Gene: ENSMEUG00000004120   Transcript: ENSMEUT00000004147
Sequence length 1315
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3976:1259:49629:1 gene:ENSMEUG00000004120 transcript:ENSMEUT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPFLWAXXXXXXXXXXXXXXXXXTQDSEEVIRIQKVTHGTVRAGLAELVALPCLFVLQ
HPQEPGPPHDPARVKWTKVRAASGQRVELPVLVAKDNVVKVARGWQGRVTLPGYPQNRSN
ATLVLGPLRASDAGLYRCEVVTGIEDEQDLLPLEVTGVVFHYRASLGRYTLSFQAAREAC
RRNSAVIAAPRHLQAAFEDGYDNCDAGWLSDRSVRYPITLSRPGCYGDRNSLPGVRSYGR
RDPHEHYDVYCFARELRGEVFYVSPPSQLTLWGARAQCQSQGAVLATVGHLYLAWQEGLD
QCDPGWLADGSVRYPIQTPRRRCGGEAPGVRTLYNFSNRTGFPEPSVKFDAYCYRAHHPT
SPPRYRDNPAADGEDLEALSAEDLPIIGQENVLPPDSQDPLVFSGEDHSLLLGLERQGDP
SSISWDAFLSHSQVPGARGDPWLNMVDPRLTEDLKVKGTGMAASEHTAATPVGTTARRRG
LNGRYFQQQLLEQALQDGVGHQDRHKPPPPGTKEAGNHVELPLITATGPCWAPRTLSNEV
DRPYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTNPCENNPCLHGXXXXXXXX
XXXXXXXXXXXXXXXXXXIDDCLSSPCLNGGTCIDEVNSFICLCLPSYGGSLCDKDTEGC
DHSWHKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSIHSPEEHSFINSFGHENAWIGLN
DRIVERDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVC
KKGTVLCGPPPAVENASPVGPRKAKYSIHSSVRYQCDKGFTQHHVATIKCHSNGKWDRPK
IVCTKPRRSHRLRRHHHHHQQHHHQHHHRKSHKERRKHKKHQKMDWEKEEEDNFC
Download sequence
Identical sequences ENSMEUP00000003770 ENSMEUP00000003770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]