SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003781 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003781
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily PH domain-like 0.0000499
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003781   Gene: ENSMEUG00000004141   Transcript: ENSMEUT00000004159
Sequence length 420
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7735:3210:23197:1 gene:ENSMEUG00000004141 transcript:ENSMEUT00000004159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKHRFILLRSPGNKVHDIKFQAQNGEEKESWIKALNEGINKGKNKAFDEVKVDKSCALE
HVTRDRVRGGQRRRPPTRIHLKEVASAASDGLSRLDLDVPDSGPPSFTSSNNISDSPPTE
IPRPPMPPTKPFPGSREAKFGDSTEKPEAKESTPAPASDNPQDHPEHQEDLETLTEGNKS
LEKPPEPPPKVQPDKLKISWENPSPEPPTPAGKESDQPTSSETASKEGGKPPAPPPKILS
EKLKASLKGSETQASKTLDPDPACSQVSVNGLTDNANGVEHVRCSETEDSPETPAEPSSA
AASPGQVSLPSLQPRCASLGDLLTESDKGQCLPLYRHQLVKIEKKMTSEREKTEQLLSQV
LGRELAPVNAETLLNQAVEQLRQATQVLQEIKVLGELNKEPPEQREKQKDLVTLYRRSAP
Download sequence
Identical sequences ENSMEUP00000003781 ENSMEUP00000003781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]