SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003831 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000003831
Domain Number - Region: 277-344
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003831   Gene: ENSMEUG00000004199   Transcript: ENSMEUT00000004214
Sequence length 389
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5321:1817:29606:1 gene:ENSMEUG00000004199 transcript:ENSMEUT00000004214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGTGNWCALVDLHPEGESADKVTILKFTLWNDPSGDLLGHIYQRAAGKSYTMVSSRSVS
RSLASELVESNDGHEEIIKVYLKGKAGDKVIHEKNIDQLKSEVQYIQEARSCLQKLREDI
SNKLERDSRDFLQQQEMQXXXXXXXXXXXXXXXXXXXXXXVQDYQNKDPESLRKTIQNLQ
AKLQEAERQRQSDRELFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAARLEKEVAGLREKIHHLDDMLKSQQR
KVRQMIEQLQNSKTVIQSKDTTIQELKEKVAYLEAENLEMHDRMEHLIEKQISPGNFSTQ
TRTKSDSLASVRISRPPNPKPLPIRVVET
Download sequence
Identical sequences ENSMEUP00000003831 ENSMEUP00000003831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]