SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003865 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003865
Domain Number 1 Region: 224-367
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-35
Family Pleckstrin-homology domain (PH domain) 0.0000146
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000003865
Domain Number - Region: 112-138
Classification Level Classification E-value
Superfamily Sec7 domain 0.00131
Family Sec7 domain 0.002
Further Details:      
 
Domain Number - Region: 10-44,254-274
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0785
Family BAR domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003865   Gene: ENSMEUG00000004246   Transcript: ENSMEUT00000004253
Sequence length 387
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1530:9502:34317:1 gene:ENSMEUG00000004246 transcript:ENSMEUT00000004253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPELSQIEVEELQTIQCHRKQLLEDIQKIKDEIAEVFAQIECFEHAQQSRQAQKEKDLCV
GKKKFNMDPSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPFNLKILQ
AFVELHEFANLHLVQALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLFDSIKSEPFSIPE
DDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLEN
LCVQKVDDPKKPYCLELYNPNCKGQKIKACKTDGDGKVVEGKHQSYKISATSPEERDEWI
KAIRASITRVPFYDLISARKKKITSKQ
Download sequence
Identical sequences ENSMEUP00000003865 ENSMEUP00000003865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]