SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004057 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004057
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000282
Further Details:      
 
Domain Number 2 Region: 375-413
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000017
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004057   Gene: ENSMEUG00000004451   Transcript: ENSMEUT00000004469
Sequence length 415
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9422:6498:53916:1 gene:ENSMEUG00000004451 transcript:ENSMEUT00000004469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNNASNTFRVVGVKLQDQQVVIN
YSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQDGGPPSQ
RQVQNGPSPDEMEVQRXXXXXXXXXXXXXXXXXXXXXXXPILPPGHPSSTATAPVPSGGP
PPPPPPPVPPPLTGAAPPPPPPPLPVSGVQGAIHDDASVSGLAAALAGAKLRRVQRPEDG
SGVSSPSGTSKSEANRTSGGGGGGGLMEEMNKLLAKXXXXXXXXXXXXXXXXXXXXXEES
STSPSPGTRGAGQPPNASDPGKKPWERSNSVEKPVASLLSRTPSSAKSPEAKSPIQSQPH
TRMKPAGSGNEGALDALDFDRMKQEILEEVVRELHKVKEEIIDAIRQELSRISTT
Download sequence
Identical sequences ENSMEUP00000004057 ENSMEUP00000004057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]