SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004217 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000004217
Domain Number - Region: 46-107
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004217   Gene: ENSMEUG00000004635   Transcript: ENSMEUT00000004636
Sequence length 137
Comment pep:novel scaffold:Meug_1.0:Scaffold37702:4:414:-1 gene:ENSMEUG00000004635 transcript:ENSMEUT00000004636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFYQTGPIYVKVNTLQGKKMVESGLQSGDFSLPESLSPCVVPPQPEMENLLQKVTGVQ
RDLEDFKQETLKAIHRLEDAYCEMSRTLAQQEEQSARVKQRLREEEDRGIVRNKVLTFLL
PREKQLRQHCRWLEHMV
Download sequence
Identical sequences ENSMEUP00000004217 ENSMEUP00000004217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]