SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004352 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004352
Domain Number 1 Region: 576-707
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-42
Family Phosphotyrosine-binding domain (PTB) 0.000000753
Further Details:      
 
Domain Number 2 Region: 415-546
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-33
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily WW domain 0.0000000000376
Family WW domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004352   Gene: ENSMEUG00000004756   Transcript: ENSMEUT00000004779
Sequence length 757
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6935:453:125031:-1 gene:ENSMEUG00000004756 transcript:ENSMEUT00000004779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMLVDSSADTLAVFMASSNTTDVVNRNSPAIPPNTLNLRSSHNELLNAEIKHTETKSST
PPKCRKKYALTNIQTAMGLSDPAAQPLLGNSSANIKLVKNGENQLRKAAEQQGPQDPNKN
VSPTAVINITSEKLEGKEPNPQDSSGCEILPSRPRRTKSFLNYYADLETSARELEQNLGN
SHVVMEEKSGGSQDQASTVIGNGDVLPRKPNKHQSSPEDGQVATVSSSPETKKDHPKTGA
KTDCALHRIQNLAPSDEESSWTTLSQDSASLSSPDETDIWSDHSFQTDPDLPPGWKKICD
IAGIYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGGK
INSDIWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFAV
RSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLNL
VDPMDRTVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSL
HEICSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFPTPKTELVQKFHVQYLGMLPVD
KPVGMDTLNSAIENLLSSSNKEDWLPVTMNVADATVTVISEKNEEEILVECRVRFLSFMG
VGKDIHTFAFIMDTGNQHFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRP
PPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP
Download sequence
Identical sequences ENSMEUP00000004352 ENSMEUP00000004352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]