SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004441 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004441
Domain Number 1 Region: 2-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.03e-39
Family FCH domain 0.000000954
Further Details:      
 
Domain Number 2 Region: 540-583
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004441   Gene: ENSMEUG00000004854   Transcript: ENSMEUT00000004873
Sequence length 596
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4798:609:32298:1 gene:ENSMEUG00000004854 transcript:ENSMEUT00000004873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQFDNLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEEPRFTS
CIAFFNILNELNDYAGQREVVAEEMGHRVYGELMRYSHDLKTERKMHLQEGRKAQQYLDM
CWKQMDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKQQLNLRTHMADENKNE
YAAQLQNFNGEQHKHFYIVIPQIYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTVSDGTISASKQDSGK
IDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPVHYCMSEIK
TGKPRIPSFRSLKRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDALNKMKD
VYEKNPQMGDPCSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSDINH
LVTQGREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHN
EGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKNSKGAVTYI
Download sequence
Identical sequences ENSMEUP00000004441 ENSMEUP00000004441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]