SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004561 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004561
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-19
Family VPS36 N-terminal domain-like 0.0000277
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000394
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.066
Further Details:      
 
Domain Number 3 Region: 161-264
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000517
Family Vacuolar sorting protein domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004561   Gene: ENSMEUG00000004990   Transcript: ENSMEUT00000005001
Sequence length 323
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4571:5576:24914:-1 gene:ENSMEUG00000004990 transcript:ENSMEUT00000005001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKFDAGVLLLSTHRLIWRDQKNHXXXXXXXXXXXXXXXXXXXXXXXXAKIVIHLHPASSN
KEPGPFQSSKSSYIKLSFKEHGQIEFYRRLSEEMTHRRWENMPVSQLMQRKSGQQPGRIR
AVGIVGIERKLEEKRKETDKNISEASEDLNKLMVKAKEVIELSKYIVNKIKDKQGDITED
ETIRFKSYLLSMGRANPVTRETPGSVHYHMQLAKQLAGILLVPLEERGGIMPLTEVYCLV
NQAGMELLSPEDLVNAYKMLEALKLPLVSGKGSLTPEEFAKSVGMSALLAKERLLLAENM
DHLYRDDSVEGLRFYPNLFMIQS
Download sequence
Identical sequences ENSMEUP00000004561 ENSMEUP00000004561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]