SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004644 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004644
Domain Number 1 Region: 269-403,706-806
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.9e-39
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 3-123
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-20
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 3 Region: 1089-1151
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.71e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 109-165
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 
Domain Number 5 Region: 169-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004644   Gene: ENSMEUG00000005065   Transcript: ENSMEUT00000005090
Sequence length 1160
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1862:196:92638:1 gene:ENSMEUG00000005065 transcript:ENSMEUT00000005090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSIKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAESSTKNVN
NSFTXXXXXXXXXXXXENRKEMEDWISLLKSVQSRELYEAAQFNVEHFSGMHNWYACSHA
RPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGV
AMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKAMXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFWKASCPGACSSPLLAFVNSKSGDNQGVRFLRKFKQFLNPAQVF
DLMNGGPHLGXXRLFQRFSTFRILVCGGDGSVGWVLSEIDTLGLHKQCQLGVLPLGTGND
LARVLGWGSLCDDDTQLLQILEKMERATTKMLDRWSIMTYELKLPTKPSILPITPEEENE
ESYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILCQTVKDFVAKVGKTYERTEENSDVAD
AMAIKCATLNEKLDQLLQTLHAEAQTVAVFKPPAPPSVEGDSVDFSSEESLSDSKGSIVE
GALKTPAQKAFKPKELMLRANSLKKAVRQIIEQAEKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXFGATPFIDPDPDSLEGYSEKCVMNNYFGIGLDA
KISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQRVQLECDGQYIPLPS
LQGIAVLNIPSYAGGTNFWGGTKEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFENTLKSWED
KQKYDASKAPPRPQLYPQQAIDLATEEEVTQMQLCSQAAEELITRICEAAKVHSLLEQEL
AHAVNACSHALNKANPRFPESLTRDTAIEIAVNVKALNNETESLLIGRVPLQLESPHEEL
VSSALHGVEVELQKLAEIPWLYCVLHSNDDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXQKWGTDEVAAWLDQLNLGEYTEIFIRHDIRGAELLHLERRDLKDLGITKVGH
MKRILQGIKELGKSTLLSEV
Download sequence
Identical sequences ENSMEUP00000004644 ENSMEUP00000004644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]