SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004674 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004674
Domain Number 1 Region: 105-204
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-27
Family Sulfatase-modifying factor-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004674   Gene: ENSMEUG00000005114   Transcript: ENSMEUT00000005125
Sequence length 246
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3912:12973:26806:1 gene:ENSMEUG00000005114 transcript:ENSMEUT00000005125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQDNNMVYLYGGVFQIGTNSRGGKDDVGSAGEVTVKPFAFWVFXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAGPGSGIRERLDFP
VLHVSWNDAQAFCAWRGKRLPTEEEWEFAARGGLKXXXXXXXXXFQVNRSNLWQGKFPQA
DTAEDGFHGASPVDAFPPQNNYGWATLQTLPRTTWASAVRLPQAGLLGNCEQRPTDKGEN
PLWLRG
Download sequence
Identical sequences ENSMEUP00000004674 ENSMEUP00000004674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]