SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004684 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004684
Domain Number 1 Region: 674-839
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 196-431
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-22
Family FCH domain 0.063
Further Details:      
 
Domain Number 3 Region: 572-631
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000718
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004684   Gene: ENSMEUG00000005088   Transcript: ENSMEUT00000005135
Sequence length 1173
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4804:13014:69437:-1 gene:ENSMEUG00000005088 transcript:ENSMEUT00000005135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSIIDLEYIRQLVSDVRRFTQLLLCLKEAVLSACLHNVVHELLGELLRILQTIINKHQIL
NSADILGAAGIVTAKVKAVGFNDISEEKRDIFQEVILIETLAFTFGNAVLFLMGDAGSDS
SLELPVSLKSQSLENISVESVGLLHEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLECARNIAKMAETTKSIIGLQEFMPFRALFLNAFDNDIESSQLSQQ
TAAALQANKFVQPLLGRKSELDKQRKAIKELWQREQKKMQETEASLKKAKLLCIQQQTEY
EKAKSSMVRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEEANEHYRVVMINMEER
RNDLEHTKNEILIQLHNLVLQCDLTLKAAVVNLFQMQHEQVVSLPVNYQSLCENAKLCDP
GRKFAEFVKAKTSPEDDKIDGKGSINNQHGSHGNVSQNSGAVHFLLEDIGSPVYRSKKIG
DKRSCSSLDIPGRPPPVRSWSVGHQGGGMCSDSESAGGSSESRSMDSPSASPGDFKRRLP
RTPSMGTMSSADELDEREPPSPSEIASFPGPFRNALKSKAALSHKLRKLRTPSKCRECDS
LVIFQGAECVECSLVCHKACLETLTIQCGHQRLHGKLHLFGGEFALAAKXXXXXXXXXXX
XXXXXXXXXXXXXXGIYRVNGAKNRVEKLCQSFENGTDLVELSEFSAHDISNVLKLYLRK
LPEPLFLFRLYNELIAVAKEIQNVNEDSRQASPEALGAELNKILKKIKALLKKLPVPNYN
TIKYLIGHLNRVVQRAEENKMPASNLGIIFGPTLIRPRQMEAKVSLSSLVDCTLQARFVE
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGITP
HNESTISERATSFEGSNNHKNALEGADASVLSFKCKMSSNLEPRIKTSARPVSLPVDRFL
LPDFLNENNSKLNSDKFGRSSTNEEMSEPKSFPNSSSRLSCYDLKTWDKPVRQYDRSSRT
RVIMPSTLQENREPESSLISDNPPFNAMQLSQPDMVPVKVVKGITEDCSLDSNRPAAFRA
RRTLQPPPGTFYMPPPNNKVKGNGKSFPETYRAAPVSVNQENTVNFVVNSDLDQVNQPKA
IREELHSSDVKPVCQRLRPKRIQDLEQREAQFV
Download sequence
Identical sequences ENSMEUP00000004684 ENSMEUP00000004684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]