SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004693 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004693
Domain Number 1 Region: 517-569
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000831
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 2 Region: 30-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000171
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004693   Gene: ENSMEUG00000005121   Transcript: ENSMEUT00000005145
Sequence length 986
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5355:51576:65509:-1 gene:ENSMEUG00000005121 transcript:ENSMEUT00000005145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCCCCPLFTGPERGSLQERNREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSIT
AKEALICPTCNVTIHNRCKDALANCTKVKQKQQKAALLKNSTALQSVSLRSKTTIRERPS
SAIYPSDSFRQSLLGSRRGRSSLSLSKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMR
NRTLSVESLIDEAEVIYNELMSDFETDEKDFAADSWSLAVDSSFLQQHKKEVMKRQDVIY
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVISLQNLIVRDIANQEKGMFLI
SAAPPEMYEVHTASREDRNTWIRVIQQSVRVCPSREDFPLIETEDEAYLRRIKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVGPGLDLPLPPRESALSLEPDSSGSTSPGVTTNGETRTFNGSIELCRADSDS
SQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARLSEGPERREKLVLSR
ANSRDGEAGRAGGAPVAPEKQATELALLQRQHALLQEELRRCRRQGEERAAEAGGLEARL
RESEQARARLEREAEEARRQLAALGQTEPLPAEAPWARRPLDPRRRSLPAGDALYLSFNL
ICRGHDRLDLPLSTRSIHRTFEDREGPELGSPEERLQDSSDPDTGSEEESCCSRLTPPHS
PRDFPRMQDIPEESESRDGEPIASES
Download sequence
Identical sequences ENSMEUP00000004693 ENSMEUP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]