SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004737 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004737
Domain Number 1 Region: 502-649
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-58
Family Ankyrin repeat 0.0000187
Further Details:      
 
Domain Number 2 Region: 383-497
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 236-354
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-21
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 4 Region: 126-222,257-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000068
Family BAR domain 0.016
Further Details:      
 
Domain Number 5 Region: 5-74
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000157
Family IMD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004737   Gene: ENSMEUG00000005166   Transcript: ENSMEUT00000005191
Sequence length 863
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1276:224:35311:-1 gene:ENSMEUG00000005166 transcript:ENSMEUT00000005191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLEGDQAILQRIKKSVRTIHSSGLAHVENEEQYSEALETFGNSHLSQNNHELSTGFLNLA
VFTREVAALFKNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRLEK
EKERSRMPGGGPGEAAQDPQRERRVFQLHMCEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XFFQDGWKAAQSLSPFIEKLAASVHSLHQAHEEDIQKLTQIRDSLRGALQLESREETSSR
KNSGSGYSIHQHQGNKQFGTEKSGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPP
VKLTLLTCQVRPSMEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFHG
EAGGGSREPAGLDGDLRDLTRLVIAEIKSRPGNGQCCDCGASDPTWLSTNLGILTCIQCS
GVHRELGVRFSRIQSLTLDVLGPAELLLAVGIGNTQFNEIMEAQLSANGASKPSSESDMS
TRRNYIVAKYVEHRFARRAGYEPHKLWTAICNRDLPAVLEAFANGLDFGQPLPRPDGQTS
GELALHLAIRLADQTSLPLVDFIIQNGGHVDAKAPDGSTALHLGALHNQPDCLKLLLKGR
ASVGTVNDAGDTALEVARKNQHKECEDLLEQAQAGTLILPFHINYPWGVSVDPGSESEDE
EEDKRCPIKLPAPARPRWGCTGLDISNKTYETIVSLGPTQASNRRSHTEELPPPLPVKSP
SRASSQGRIGHGSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
GITEVDSSKAELHLASSGKLSQD
Download sequence
Identical sequences ENSMEUP00000004737 ENSMEUP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]