SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004792 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004792
Domain Number 1 Region: 48-189
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-51
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000174
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000004792
Domain Number - Region: 210-363
Classification Level Classification E-value
Superfamily Tropomyosin 0.0118
Family Tropomyosin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004792   Gene: ENSMEUG00000005238   Transcript: ENSMEUT00000005254
Sequence length 383
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1951:53:74685:-1 gene:ENSMEUG00000005238 transcript:ENSMEUT00000005254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALARRRPHSPAEWSRAGTEWGAHDPHVPSGKRLRRRDANAIGPVAAMGAMGEQPIFTTRA
HVFQIDPNTKKNWMPASKQAVTVSYFYDSTRNSYRIISVDGAKVIINSTITPNMTFTKTS
QKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKLARDKSQEKIETSSNHSQES
GCETPSSTQASSVNGTDDEKASHGPAETHLKSENEKLKLALTQSASNVKKWEIELQTLRE
SNARLTAALQEFAASVDQWKKQFSICRDENDRLRTKIEELEEQCNEINKEKERNAQLSRR
LEALESEIQEKERELKDLRKQGEIIPQLMSECDFVTEKLEASERENQNLEDKVRSLKTDI
EESKHRQRHKMELKNFLEVLDGK
Download sequence
Identical sequences ENSMEUP00000004792 ENSMEUP00000004792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]