SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004898 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004898
Domain Number 1 Region: 179-259
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000004898
Domain Number - Region: 86-151
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0034
Family HBL-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004898   Gene: ENSMEUG00000005360   Transcript: ENSMEUT00000005372
Sequence length 262
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3016:5077:43999:-1 gene:ENSMEUG00000005360 transcript:ENSMEUT00000005372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEKEIQVAHFTVDNQDISLWPRDPPPKKESPAIPRTLPSVYVALFLLAVGFVVFLLTMII
LYPQLLGRINDVKTSVQMLQGRAENTSVFLSSEIRKLRNKLEDSRTQVQTLNRSLGNANI
QIKLLSAKLRQDTEQLQVLRSTWKELEDLNSQIPMLKQDLKKSRELTANAAQEYILEMAS
QDWRFFGGNFYYFSTMKKSWYSAEQLCTTRDSHLTSVTSAKEQEYLIRRAKGIPYWIGLT
SLDTEGSWHWVDGTPYMETTSR
Download sequence
Identical sequences ENSMEUP00000004898 ENSMEUP00000004898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]