SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005113 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005113
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.44e-59
Family BAR domain 0.002
Further Details:      
 
Domain Number 2 Region: 400-514
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.24e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 260-365
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-24
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 609-727
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.68e-24
Family Ankyrin repeat 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005113   Gene: ENSMEUG00000005587   Transcript: ENSMEUT00000005612
Sequence length 777
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2855:613:85739:-1 gene:ENSMEUG00000005587 transcript:ENSMEUT00000005612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIVMIDTGKAFCVANKQFV
NGIRDLAQYSSKDAVVETSLTKFSESLQEMINFHTXXXXXXXXXXXXXXXXXXXXDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQXXXX
XXXXXXXXXXXMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKRDMEQ
KHSTIQQKDFSSDDTKLEYNVDAANGIVMESYLFKRASNAFKTWXXRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDVERRFCFEVVSPTKSCMLHADSEKLRQAWIKAVQTSI
ATAYREKGDETEKLDKKSSPSTGSLESGNESKEKLLKGESALQRVQCIPGNASCCDCGLP
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
AKIEKMGIKKPQPGQRQEKEAYIKAKYVERKFVDKDSASSPPEEGKRVLCQGQEEKGLST
SKPAIEDHVGTSARSLVKSNDSGIQQCADDVREGLSSVVSANSLYEPEGERRDSSVFLEF
KHLHPGLQLYRASYEKRLPDMAEALAHGADVNWANPEEKKATPLIQAVLGGSLVTCEFLL
QNGANVNQRDAKGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGNDPLSIAVEAANAD
IVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences ENSMEUP00000005113 ENSMEUP00000005113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]