SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005180 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005180
Domain Number 1 Region: 526-595
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000287
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005180   Gene: ENSMEUG00000005666   Transcript: ENSMEUT00000005688
Sequence length 622
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3445:6086:14022:1 gene:ENSMEUG00000005666 transcript:ENSMEUT00000005688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHDISLEEFEDEDLSEITDECGISLHCKDALALRPQRGGLVPGGGGCGGAGSRLQAEML
QMDLIDAAGDTPGAEEEEDEDEDEDEDRRKRAGPPGAGQQQPPRSLLSSSAGQGAAGARR
PSGQDSGDTYRPKRPTTLNLPQVPRTQDTLNNNSLGKKHSWQERVSLSSSPLKTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRPHP
SISEEDEGFDCLSSPERSEPPGGGWQDSRAELPRASLSSDTSALSYDSVKYTLVVDEHAQ
LELVSLGQCYSGYSDESDSATVYDNCVSSPYESAIGEEYEEAARPRPAVCLSEDSSPDGP
DVHFSKKFLNVFMSGRSRSSSAESFGLFSCTINGEEQEQTHRAVFXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAKNSDWVDQFRVKFL
GSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEINVRGVKIVVKAEDSQEHKR
AFQQFYKQFVEYTCPTEDIYLE
Download sequence
Identical sequences ENSMEUP00000005180 ENSMEUP00000005180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]