SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005285 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005285
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-56
Family IMD domain 0.0000000719
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000005285
Domain Number - Region: 213-245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family IMD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005285   Gene: ENSMEUG00000005792   Transcript: ENSMEUT00000005804
Sequence length 528
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8343:1808:166400:1 gene:ENSMEUG00000005792 transcript:ENSMEUT00000005804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSEEVHRLTENVYKTIMEQFNPSLRNFISMGKNYEKALAGVTFAAKGYFDALVKMGEL
ASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKK
YQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKDMLTQKLPLWQQSCADPNKIPDRAIQ
LMQQMAASSNGTVMPSSLSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENVPVMN
GVSGPDSEDYNHWSDRKPAQPKSLSPPQTQNKMSDSYSNTLPVRKSVAPKNSYATXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRGWFPFSYTRVLDSEVSDRLHMSLQQGKSSSTGNLLDKEDLAIPPPDYGVSSSRAFP
AQTANTFKQRPYSVAVPAFSQGLDDYGSRSVSRNPFANVQLKPTVTND
Download sequence
Identical sequences ENSMEUP00000005285 ENSMEUP00000005285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]