SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005629 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005629
Domain Number 1 Region: 243-440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 6-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-47
Family BAR domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005629   Gene: ENSMEUG00000006150   Transcript: ENSMEUT00000006176
Sequence length 653
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1537:2421:21936:1 gene:ENSMEUG00000006150 transcript:ENSMEUT00000006176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQETAEFLSEDLLQVEQRLEPAKRAAHNVHKRLQACLQGQSGADMEKRVKKLPLMALSHT
MAESIKELDPDSSMGKALEISCSIQSQLARVLAEFEMALERDVLQPLNKLSEEELPSILK
HKKNLQKLVLDWNALKSRLSQMAKSSSLGPGVGGPGGHNATTNKLETLKEEEEDLKRKVE
QSKDEYLSDLYHFATKEDSYANYFINLLELQASYHRRSLSSLDTALAELKETHGHTADVP
SIKVYGVALKTHLQETGRDIALPLEACVLMLFSEGMKEEGLFRLAAGASVLKRLKQTMAL
NPSSLEEFCSDPHAVAGALKSYLRELPEPLMTSELYEDWMRAASLKEPMARIEDLQEVCG
KLPQENLCNLRYLIKFLARLAKEQEVNKMTPSNIAIVLGPNLLWPPTRDGDQAQLDTASV
SSIQVVGVVEALIQNSDTLFPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRPA
PARPMVPPPQVQNPRSSPPAPTSAPASGSPATPRALPRRQTGSNIKAPSVPPPLPPQPPQ
PMRRLSRPSPASPPVLRLRSLGSPEVEGDSYAAQGGVTIPPQPRPRNLASETD
Download sequence
Identical sequences ENSMEUP00000005629 ENSMEUP00000005629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]