SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005842 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005842
Domain Number 1 Region: 227-361
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-30
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily PR-1-like 0.000000000000157
Family PR-1-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005842   Gene: ENSMEUG00000006395   Transcript: ENSMEUT00000006417
Sequence length 371
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5109:32925:46685:-1 gene:ENSMEUG00000006395 transcript:ENSMEUT00000006417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWSDQLARLAQEQAARCSPGLAPCPGQALQVGWNVQLLPAGAASFTDVVTSWFREGQWYT
YSAAQCASKLTCAHYTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXRCSVRCQHGRFREEECSCLCDVGYGGAECAIKVQFPFHACDLWIDGSCFMISP
EADTYYGAKSKCQEKGGMLAQIENQKVQDILAFYLGRLETTNEVTDADFETRNFWIGLTY
KTSKDSFRWATGERYSFTSFAFGQPDNQGFGNCVELQASAAFNWNDQRCKTRNRYICQFA
QEHISQWDLEP
Download sequence
Identical sequences ENSMEUP00000005842 ENSMEUP00000005842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]