SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005962 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005962
Domain Number 1 Region: 277-413
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 80-158
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000516
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005962   Gene: ENSMEUG00000006531   Transcript: ENSMEUT00000006548
Sequence length 414
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_957:2358:216770:1 gene:ENSMEUG00000006531 transcript:ENSMEUT00000006548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSSTSSDASAEKLNSSHRSTGAVQMRIKNANIHHDRLSQSKSMILTDTGKVTEPISRHR
RNHSQHVLKDIITPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSNRKIEFYKES
KQQPLSNLKTGQKPECLDLCGAHIEWTKEKSSRKNVFQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPKDQSCTSRNLELFKIQRSSSTELLDHFDREIKEQKPEHRKSLIFRLQH
SVSDTSDKSRVKSRLKKFINRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPRFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYCFFEQFVEAIKKQDNNMRIEAIKALVQKLPPPNRDTMKILFGHLT
Download sequence
Identical sequences ENSMEUP00000005962 ENSMEUP00000005962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]