SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006054 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006054
Domain Number 1 Region: 1552-1664
Classification Level Classification E-value
Superfamily C-type lectin-like 2.12e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000384
Further Details:      
 
Domain Number 2 Region: 1440-1549
Classification Level Classification E-value
Superfamily C-type lectin-like 1.13e-42
Family Noncollagenous (NC1) domain of collagen IV 0.0000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006054   Gene: ENSMEUG00000006582   Transcript: ENSMEUT00000006648
Sequence length 1666
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7718:9226:97577:1 gene:ENSMEUG00000006582 transcript:ENSMEUT00000006648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGGAFGRVLPMLLQIRLLLLLLVVAAPTVGKXXXXXXXXXXXXXXXXXXXGEKGFPGC
PGTPGQKGLPGPEGIPGPQGPKGSPGIPGFIGSKGTRGMTGLPGFPGPPGLPGSPGNTGP
YGPPGLPGCNGTKGEQGFPGPPGIPGHPGLPXXXXXXXXXGAPAREEVIGNGGRGDPGLP
GIPGRQXXXXXXXXXXXXXXXXXXXXXGFPGEMGPPGPKGHMGVKGIGEKGDRGIKGLTG
PPGPPGAVIVTLTGPDNLTEYKGDKGDKGSMGEPGPPGPKELPGESYGSEKGVPGDPGPQ
GKPGKDGAPGFPGLPXXXXXXXXXXXXXXXXXXGFKGDIGPPGFRGPTEYYNGYLEKGNE
GAPGPPGPKGERGSHGPRGPPGDVGRAGASRPGLRGTPGPPGIKGSKGERGPPGMNVMGP
PGPPGFPGTPGYKGIPGLPGLPGKVAFRSGPPGDHGDPGHLGSPGMPGVYGPKGEAGPLC
TQCTYTPGPPGLPGLPGLDGEKGTQGGHGPDGLKGNPGSPGHSGLPGFPGFPGAPGDQGR
KGEKGETSHEGEVGDPGDPGNRGDPGKKGSDGIPGKPGTKGLPGPKGEPVVNGEKGEKGF
PGNPGDPGHPGPMGPAGLSNYGPPGKPGPKGATGVPGFPGSPGNDXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRPGSMGPSGNPGCPGSDGEAGLPGIGVPGPPGHKGDRGFPGAK
GSPGCPGEMGKLGSPGIPGFPGAKGDPGTAMPGKPGITGFQGEKGSSGENGANGLPGLPG
PPGFPGNEGPNGPPGEPGLPGPPGYNGIPGICIPGAKGTQGLPGLNGLKGLQGPKGDPGI
PGLDRSGSPGEPGPPGLPGHQGDKGLVGPAGHPGAPGHPGPPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSFGIPGRKGKKGLPGAKGERGNKGTQGPSMISADVGEKGEPGREXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGDPGMMGHPGEPGPPGGPGSMGHMGMP
GPKGKKGTAGHPGITGRPGLPGIQGMKGQKGEPGFAKDLQPGPPGPKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPGPAGDLGLKGCKGFPGTPGMKGPPGPLG
AQGPPGPMGEKGKQGGDAFPGPAGEKGKLGLLGALPGPRGLPGLEGDKGNEGSPGLPGIY
GMKGVMGDVGPIGPTGMTGPPGPPGLPGTLVPGQKGNQGPPGLRGSPGDTGPPRPPCEYI
SGKKGEKCFPGHSPTGQPGTIDPGPPGHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LQGPRGQPGKPGKPGIPGPVGEKGNKGSKGETGPPGSVGLPGLKGKPGNFGPPATGPSIR
GFIFTRHSQSTEIPTCPGGTVPLYSGYSLLFVQGNEQAYGQDLGTLGSCLQRFTTMPFLF
CNTNDMCNFASRNDYSYWLSTTAPMPTNMAPVTGRALEPYISRCTVCEGPAMAIAVHSQT
TDIPLCPDGWISLWKGFSFVMYTSAGSEGSGQALASPGSCLEDFRANPFIECHGRGTCNY
YSNSYSFWLASLNPRRMFRKPIPSTVKAGELEKIISRCQVCMKRRD
Download sequence
Identical sequences ENSMEUP00000006054 ENSMEUP00000006054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]