SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006256 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006256
Domain Number 1 Region: 187-458
Classification Level Classification E-value
Superfamily Kelch motif 1.05e-39
Family Kelch motif 0.0015
Further Details:      
 
Domain Number 2 Region: 645-784
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-22
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 3 Region: 10-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 925-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006256   Gene: ENSMEUG00000006854   Transcript: ENSMEUT00000006880
Sequence length 1291
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3744:16015:147752:1 gene:ENSMEUG00000006854 transcript:ENSMEUT00000006880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGSAGFVTDGPGNYKYKTKCTWLIEGQPNRILRLRFSHFATECSWDHLYVYDGDSIYAP
LVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYSFDMCPNNCSGR
GECKLSNGSSTAKCECSKYWRGESCDIPSCTNDCGYPDRGFCNSGNVRECSCFPPWQGPG
CAIPVPANQSFWTREEHSQPKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAYDLDAG
EWLPLNQTVNDVVVRYGHSLALYQDKLYMYGGKIDSTGNVTNELRVFHIKNESWVLLAPQ
AKEQYAVVGHSAHIVTMKNGRVVMLVIFGHCPLYGYISNVQEYDIDKNTWSILQTQGALV
QGGYGHSSVYDAKTNSLYIHGGYKAFSANKYRLADDLYKYDVDTQMWTILKDSRFFRYLH
TAVIISGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXADPDKCDQHTDCYSCTANTNDCQWCNDHCVSMSSNCTEG
QVSISKYENCPNNPMYYCNKKTSCKSCAMDQNCQWEPRNQECVALPENICGAGWHLVGNS
CLRITTTRDNYDNAKLSCRGMNAFLASLTTQKKVEFVLKQLRLMQSAQSLSKTTLTPWVG
LRKINVSYWCWEDMSPFTNSLLQWLPSEPSDAGFCGILSEPNVRGLKAAICINPLNGSIC
ERPXXXXXXXXXXXXALRTMCGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYT
MSSCPPENCSGYCTCGHCLEQPGCGWCTDPSNTGKGTCIEGSFKGPMKMPSQAPTGSHYP
QPRLNSSMCLEENRYNWSFIQCPACQCNGHSKCINESICEKCENLTTGKHCETCISGFYG
DPTNGGTCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCEVENRYQGNPLKGTCYYT
LLIDYQFTFSLSQEDDRYYTAINFVATPEEQNRDLDMFINASKNFNLNITWATSFTAGTQ
AGEEMAVVSKTNIKEYKDSFSNEKFDFRSHPNITFFVYVSNFTWPIKIQIAFSQHSNFMD
LVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASISVALETD
EEPPDLIGGSIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAVASALVD
ISQQMPIAYKEKSGAMRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSMEUP00000006256 ENSMEUP00000006256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]