SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006265 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006265
Domain Number 1 Region: 52-133
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000889
Family BAR domain 0.00077
Further Details:      
 
Domain Number 2 Region: 168-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000476
Family BAR domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006265   Gene: ENSMEUG00000006859   Transcript: ENSMEUT00000006890
Sequence length 798
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1017:22117:127525:-1 gene:ENSMEUG00000006859 transcript:ENSMEUT00000006890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIKTGIFAKNVQKRLNRAQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEEEFQKAQKVF
EEFNIDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIALXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDSGPLRIAKTPSPPEEPSPLPSPVASPNHTLAPASPAPARPKSPSQLRKG
PPVPPLPKVTPTRELQQENIISLFEDNFVPEINVTATSQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDASKSLSLCNLIMEETPDLGSAEDM
PDPQSDLGSFIWGLDVSTDSMSQEVTAGDSGEETVPEPGAEEHARPAVTEENSLISPEGE
PEAGFARSLSPEMEQLSESLLDSEMPVVEAGDLGEEIHPSVERTKEEEKVEESLWGSLET
REKASSGTFNGFTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIIPSVVIEPASNHEG
EDDQDTELSMAREVRETREDISPQDDFSEPSVLASDQKTQEDAQATAPVGPPLPSSSEAA
QVPPGFLYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAGRLIGVKESDWLQFR
DLDTYKGLFPENFTHRLD
Download sequence
Identical sequences ENSMEUP00000006265 ENSMEUP00000006265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]