SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006295 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006295
Domain Number 1 Region: 38-64,129-321
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.07e-48
Family Nuclear receptor ligand-binding domain 0.0000000421
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-26
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006295   Gene: ENSMEUG00000006900   Transcript: ENSMEUT00000006922
Sequence length 402
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7140:22521:47525:1 gene:ENSMEUG00000006900 transcript:ENSMEUT00000006922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGINSLCSICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYSCRFNRQCVIDKDKRNQCR
YCRLRKCFRAGMKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNNYIIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVF
FDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQ
IQFVKLFGMVKIDNLLQEMLLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXTETPLLSPPQGSGQETYKMPTKQASVISHQSIPKQKQL
Download sequence
Identical sequences ENSMEUP00000006295 ENSMEUP00000006295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]