SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006310 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006310
Domain Number 1 Region: 12-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.86e-45
Family FCH domain 0.0098
Further Details:      
 
Domain Number 2 Region: 609-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-32
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 3 Region: 442-549
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-27
Family SH2 domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006310   Gene: ENSMEUG00000006910   Transcript: ENSMEUT00000006938
Sequence length 775
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8737:3511:15869:1 gene:ENSMEUG00000006910 transcript:ENSMEUT00000006938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSPQGHGALQKLQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMALQEGGSQV
RNLDHVSQISQSWTEITRQTESLSRLLRQHAEDLNSGPLSKLSILIRERQQLRKNYSEQW
QQLHQDLTKIHSLDIEKLKSQYRVLARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLY
AHHNRYVLGVRAAQLHHQHHHQLLLPXXXXXXXXXXXXXXXXXKEILQEYIEISSLVQDE
VVTIHREIAAAAACINPYTEYEGFLQQYGSSPNTPPCVTFDDTLLEEVEQLEAGELQLNE
LTIESVQHALTSVNEELTTATEMVMSRQQVVTQMQKEIQREEESIHPRERVQLLGKRQAL
QEALQDFQMALCSQAKLKAQQDLLQSKLEQLGPGEPPPVLVLQDDQHSTSSTEQEREGGR
TPTLEILKNHISGIFRPKFSLPPPLQLIPDIQKPLQDQVWYHGAIPRTEVQELLVNSGDF
LVRESQGKQEYVLSVMWDGQPRHFIIQSSDNLYRLEGDGFPSIPLLIDHLLRSQQPLTKK
SGISLNKAFPKDKWALNHEDLVLGERIGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXILKQYSHPNIVRLIGVCTQKQPIYIVMELVQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDLAARNCLVTEKNVLKISDFGMSREGADGIYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYSNLTNQQTRELVEK
Download sequence
Identical sequences ENSMEUP00000006310 ENSMEUP00000006310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]