SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006351 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006351
Domain Number 1 Region: 162-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-40
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 298-419
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-33
Family Spectrin repeat 0.0000742
Further Details:      
 
Domain Number 3 Region: 2179-2293
Classification Level Classification E-value
Superfamily PH domain-like 2e-33
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 4 Region: 1643-1796
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-28
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1535-1690
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-27
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1013-1159
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-26
Family Spectrin repeat 0.00000703
Further Details:      
 
Domain Number 7 Region: 818-953
Classification Level Classification E-value
Superfamily Spectrin repeat 5.42e-25
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1854-2007
Classification Level Classification E-value
Superfamily Spectrin repeat 5.96e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 9 Region: 1429-1583
Classification Level Classification E-value
Superfamily Spectrin repeat 1.59e-23
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 10 Region: 428-530
Classification Level Classification E-value
Superfamily Spectrin repeat 8.4e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 1289-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000245
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 604-665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000016
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 13 Region: 1388-1443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000671
Family Spectrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006351   Gene: ENSMEUG00000006928   Transcript: ENSMEUT00000006981
Sequence length 2331
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3800:33801:126312:-1 gene:ENSMEUG00000006928 transcript:ENSMEUT00000006981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPPDMTSATEFDNVGIQQYSRINARWDSPDNELDNDNSSARLFERSRIKALAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQDIVVQTQEGQETRSAKD
ALLLWCQMKTSGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFEKLKDSNARHNLEHA
FDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHA
IETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGLQQQLQSFSTYRTVEKPPKFQ
EKGNLEVLLFTIQSRMRANNQKVYTPHEGKLVSDINRAWENLEEAEYRRELALRNELIRQ
EKLEQLARRFDRKAAMRETWLSENQRLVAHDNFGYDLAAVEAAKKKHEAIETDTAAYEER
VKALEDLAQELEKENYHDLKRIKARKDNILRMWSYLLDLLQSRRQRLEMTLTLQKLFQDM
LHSIDWIDEIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXYQPCDPQVIQDRVSHLELCFEELSFMAAGRKARLEQSKRLWKFFWEMDEAESWIKEKE
QIYSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLGKKHKDFLEELEESRGVMEHLEQQAQSFPQEFRDSPDVNNRLQALRELYQQVVAQA
DLRRQRLQDALDLYTVFGETDACELWMGEKEKWLSQMEIPDTLEDLEVVQHRFDILDQEM
KTLMAQIDGVNLAANSLVDSGHPRSAEVKNCQDHLNHRWEAFQTMVSECRKAVDSALSVH
NYCVDCEETGKWIMDKTEVVESTKDLGRDLAGVIAIQRKLYGLERDVAAIQSRVGALERE
SQRLIQEHPELQENIGKRQAYVEELWQKLQQALRGQEASLGEASQLQKFLQDLDDFQAWL
FMAQKAVASEDAPDSLPEAEQLLQQHAAIKDEIDGHKDDYQNVKVSGEKVIQGQTDPEYQ
LLGQRLEGVDTGWDALCKMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLTLWINDKLLSSQDISYEEARNLHNKWQKHQA
FMAELASNQGWLDKVDEEGRQLIEEKPQFTDVVTQRLRQLHRLWDELQSTTQEKAQHLFA
ASRSDLHAQTYADLNKWISAMEDQLKSDDPGKDLTSVNRMLTKLKRVEDQVNVRKKELGE
LLSQVPPVGDEADGTEPSIEKRFLDLLVPLGKRKKQLESSRAKLQINRDIEDETLWVEER
LPLAQSADYGTNLQSVQLLMKKNQTLQNEIVGHAPRIEDVLHRGHELVEMAEIDCQDIAE
RLGHLQGSWKSLQEETAQRLQRLREANEAQQYYLDAGEAEAWISEQELYVISDETPKDEE
SAIVMLKRHLRQQRSVEEYGKNIKQLAGRAQKLLSAGHPEGEQIIRLQGQVDKQYAGLKD
MAEERKRKLENMYHLFQLKREADDLEQWIAEREVVASSQEMGQDFDHVTLLRDKFRDFAR
ETGAIGQERVDNVNLIIERLIDAGHAEAATIAEWKDGLNEIWADLLELIDTRMQLLAASY
DLHRYFYMGEEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQD
VATRLQTAYAGEKADEIQSKEQEVSASWQKLLDACAGRRAQLVDTADKFRFFSMVRDLLS
WMESIIRQIDTQEKPRDVSSVELLMKYHQSIKAEIETRSNFSTCLELGESLLQRQHQASX
XIKEKLNQVMSRRQEMMEKWDNRAERLHLLLEVCQFSRDASVAEAWLIAQEPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRHQQEEERGGREEKLTLEPLFKVLDT
PMSESEETATTLPAQLDRSHSMQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNNELTF
YKDAKNLAMGVPYHGEEPLGLRHAICEVAADYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAITESQSIQVKAQSLPLSSIAGTDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences ENSMEUP00000006351 ENSMEUP00000006351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]