SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006472 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006472
Domain Number 1 Region: 173-271
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-24
Family Pleckstrin-homology domain (PH domain) 0.0000259
Further Details:      
 
Domain Number 2 Region: 14-74
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.05e-21
Family Adapter protein APS, dimerisation domain 0.0000531
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000148
Family SH2 domain 0.0000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006472   Gene: ENSMEUG00000007074   Transcript: ENSMEUT00000007106
Sequence length 617
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6648:23898:48914:1 gene:ENSMEUG00000007074 transcript:ENSMEUT00000007106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDAPCQDTSPVPDWREFCELHAQAAAVDFAQKFCRFLRENPQYDTPGAEASFSHHFAA
NFLDVFSVEVSRVFISEPNARGTALREETMDPVAGTPAHKVSSYGHSRSSEDVSFRAAVK
PRFKKGFSLRNMSLCVVDGMKEMWHRRASPEPEAAAIRASSPAEPREKWAHRLRLSRGPA
SKVELADIQREGTLRYMVADDSAVGGSQWQKCRLMLRKAVKVEGERFLLEFYVPPKASKP
KVSIPLSAIIEVRTTMPLEMPDKDNTFVLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSPGENAQVDLEIVLSDYPWFHGTLSRIKAAQLVLA
GGARNHGLFVIRQSETRPGEYVLTFNFQGKAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSPAPGTVPPPPSCWSEPPTQHYFSSFGPG
PFQPASPSEGGGASSSSASSSSGRPAPAHRTEGTLSARSRSNSAERLLEPLAGTEDYHDS
EGARNRARAVENQYSFY
Download sequence
Identical sequences ENSMEUP00000006472 ENSMEUP00000006472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]