SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006642 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006642
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000137
Family Link domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006642   Gene: ENSMEUG00000007267   Transcript: ENSMEUT00000007296
Sequence length 666
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_326:15552:58714:1 gene:ENSMEUG00000007267 transcript:ENSMEUT00000007296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNITCRFAGVYHVEKNGRYSISRTEAADLCKAFNSTLPTLKQMEQALSIGFETCXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLDKEDCSSVTDIPSTFEGQ
ITSIVNPDGTRYTKKGEYRTNPEDINPSFNPEDDGSSGSAGERSTMGGSTLTSTSGTVHK
TTAMKQEDDWHTTTRTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LASTRATSQETIQGRQHWAHGHPNPEEQPQTTTKVTVVDMNRSADRAHGENSTQESQPSL
IPDGNHENYDGHHSSSTTLEIPSRTTQETTTQQQGGGWFWWLRQPLKEDAKTTAETTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAPHHSTADPNEGWIEDK
GTTDYPPMATEQDHSQSPFRPHTGLDDSHKHSTVPSPTSLNGDAIRIWKLPEDSATPVED
SFVHFPGTKDNTANSSRTHMTTGLPGVTKPTVLGGFIPDIRSPSXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLIILSALLALALILAVCIAVNSRRRCGQK
KKLVINSGNGAVDDKKSSGLNGDASKSQEMVHLVYKEQSDGQVGQDECMTADETRNLQNV
DMKIGV
Download sequence
Identical sequences ENSMEUP00000006642 ENSMEUP00000006642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]