SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006738 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006738
Domain Number 1 Region: 487-674
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.35e-55
Family Oxysterol-binding protein 0.0095
Further Details:      
 
Domain Number 2 Region: 739-820
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.71e-17
Family Oxysterol-binding protein 0.016
Further Details:      
 
Domain Number 3 Region: 18-95
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000106
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006738   Gene: ENSMEUG00000007362   Transcript: ENSMEUT00000007397
Sequence length 820
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_813:9207:68452:-1 gene:ENSMEUG00000007362 transcript:ENSMEUT00000007397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSWEVVEGLRGEMNSTQEPQIQKGFLLKKRKWPLKGWHKRFFFLEKGILKYAKNLADIER
EKLHGSIDVGLSVMSVKKSSKCIDLDTEEHIYHLKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSISKQSSLQTGSSLSFSCGEARLPMWP
QSSEDMEKCSKDLAHCHTYLVEMSQLLQSMEVLHRTYSAPAINALQGGAFESPKKEKRPQ
RRWRARAISKEAKGMLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXYFTLKSAFNAISNEREKLKQMMEHESSSSPSAQIVGLKHALSSXXXXXXX
XXXXXXXXHAELFDSAAGAKSSDGLAEEISGEESRALVHQLSNESRLSITDSLSEFFDAQ
EVLLSPSSSENEASDDDSYVSDISDNASMDNLSNDLENERQTLGPILESDPRGQTKRRTC
LPAPCPNTSSISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDRVSRT
PGPLERMVYVAAFAVSAYASSYFRAGSKPFNPVLGETYECIHEEKGFQFFSEQXXXXXXX
XXXXXXXXXXXXXXXVRWKNKFWGKSMEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILS
GQRWIEHYGEIIIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXPMPKGHEQYYGFTQFALELNELDPLTKPYLPSTDTRFRPDQR
FLEEGRIEEAETQKQRIEQLQRERRRVMEENNLEHEPRFF
Download sequence
Identical sequences ENSMEUP00000006738 ENSMEUP00000006738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]