SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006897 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006897
Domain Number 1 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Third domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 155-261
Classification Level Classification E-value
Superfamily Second domain of FERM 4.81e-23
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 45-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000103
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006897   Gene: ENSMEUG00000007536   Transcript: ENSMEUT00000007573
Sequence length 1617
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5651:1570:40912:1 gene:ENSMEUG00000007536 transcript:ENSMEUT00000007573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLESAFISAAKKAERRSSPVKVQFKVTASKKDPDMLKKEALLLIPNVLKVFLENGQIKSF
TFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYASPEQSHKFLLLQDKQPLAHXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRNDVIRERFGMDPKPEMLLGLAALHI
YITVSAARPSQKFSLKNVEKEWGLEPFLPPSLLQSIKEKNLRKSLSQQLKAHQAHPPSGA
KGSQMQAKLQYLRILNELPTFTGVLFNTVGLDEKHSATTLLVGPRHGISHVIDLKTNLTT
VLSEFSKISKIQLFQENQSVARVETSILDAKPLVLLMEWPEATNFACLIAGYCRLLLDSR
KMMFSKTPSQPPPPPMNKADYMQNAHHPVSGGHLGKKESSFVGSMVSSPGKPCRRPPTAN
SELVSFCYLHMREQRKERESQTDTNENLIFFEETRPRTKSDPTSKSSGQGYSEAANDYDT
TRPVQVPCTSRARAYTIDNTLGAEALNFYCDSCKAKLKNQLGSRKSRRPGTSCDNMVDLM
SLPPPGSEEEEEEEDESTSLLPAIAAPPPGFRDNSSDEDDPKRRVAQSQEQGRPLCGILY
DEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAAAEDCPHPPPPQTAGLIVLATI
TPESSLDSGHETNSSELTDMSEMVSAMKQRQNATYFLAQHINKEGLMARKDLSFRIPSCT
TQAVLTAPYPLGRQEASLASAALERQPPGQGSGPTGGRRRLDPTEVQTHRELPPALAVHP
ALASQLSSEQRSQGLMSWGAEGKDPDHPKAALEMSLRATPAALSGDQGTELRDKVPKEVR
LSPKLILDSKGSVTPAILSAALQQVVPNKALASPGAAVDSTPRGERKQGPSAGSGNGSGI
CKNLKAKGSPSSAEITLNYQQQQSPEASPRAKAPSRTQADPMRLSLIEEDKLSAQGLPAK
SYLPRKVREPLGKQVSGEVGSRGGSESQLSLKQGFAMGQGEEGRPKRLEDSGRGPRAGHW
HLQSSGGQPRGPSALGLWASGRQANTMPSRKAAKALDGAHSDPDGPAKPKASKAPFRLRN
LFSATFPSLMKKETDERQAQLQKVKQYELEFLEELLKPQTKGDLPAPEYLHPSGPGRCSC
QLRSSPVQQVPGISREQRRSCDCKRICRGGRPQAAQLPAPSLRGRERNRALPLPKRLEGP
SALSFSSPGKSCRVRSTSLESRECRSEPESGVSCLATCASRGECMAAPHYRKLMRRYSVS
ELDKSDQASLTSDIYQHPPLGLLPKEADAGFPQSVGPKGKPHELMSLGDPSYVQVTPEGK
GPKATATFSLPEEVYPGPADLEEDGEGDRCCSIRYCFYYRKCDMADDGSDGKDELSYSIP
MQFLPGMKLDDQVVPVVSHTLQVLDATTCSSSSPEDNQTQEIDLRISTFEGSLAKINALQ
GHVYALPDGFLAVQLDTNELLAVLRQCVVNPEVRGSKPHTSQLSQYKLELALKFKELRAS
CRRVAAVDKSPTHMLAAITGSFQVLSGLIETFVRLVYIVRSEAQRQELLVKVEEVVKNYT
FLLRAAEESTARTLSQQQWRRRRRRQWAVGPVSERPPVSSATVMSTFTRSLKTLINK
Download sequence
Identical sequences ENSMEUP00000006897 ENSMEUP00000006897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]