SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006946 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006946
Domain Number 1 Region: 279-349
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.88e-22
Family Intermediate filament protein, coiled coil region 0.00097
Further Details:      
 
Domain Number 2 Region: 38-73
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000523
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000006946
Domain Number - Region: 43-183
Classification Level Classification E-value
Superfamily Tropomyosin 0.0353
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006946   Gene: ENSMEUG00000007607   Transcript: ENSMEUT00000007625
Sequence length 392
Comment pep:novel scaffold:Meug_1.0:Scaffold3164:19196:25292:-1 gene:ENSMEUG00000007607 transcript:ENSMEUT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLCLPNSCRSACPLPGTLDIPANIGNCGNYGEGFLNGHEKETMQFLNDRLANYLEKVRQ
LEQENAELETKIQEWSKCHPSYVCPDYQSYFRTIEELQQKILCTKAENNRLVIQVDNAKL
AADDFRIKHESELSLRKLVEADMCGMHKLMDSLTLAKCDLEAQVESLKEEQLSLKSNHEQ
EVHNLQCQLGDKLRIELDTAPPVDLNRVLGEMRCQYEAMVETNRNDVEQWFLAQSEGINL
QAMSCSEEIQCCQSQLLELRCSANALEIEREAQHKLKECLENSLCESEARYSTELAQMQY
LIGNVEEQLAEIRADLERQNNEYQVLLDVKARLECEISTYRNLLESEDCKLPCNPCSTPA
SCVPPPCGPRPNCGPDTCCPPRSACGTNLSSR
Download sequence
Identical sequences ENSMEUP00000006946 ENSMEUP00000006946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]