SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007121 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007121
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.99e-55
Family IMD domain 0.00000612
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007121
Domain Number - Region: 215-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00701
Family IMD domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007121   Gene: ENSMEUG00000007795   Transcript: ENSMEUT00000007819
Sequence length 511
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7133:2239:101674:-1 gene:ENSMEUG00000007795 transcript:ENSMEUT00000007819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSEEVSKLTENTYRNVVEQFNPGLRNLINLGKNYEKAVSAMIVAGRAYYDGVAKIGE
IATGSPVSTELGHVLIEISNTHKKLNDSLDENFKKFHKEIIHELEKKTELDVKYMNATLK
RYQTEHRSKLDSLEKSQAELKKIRRKSQGGRNALKYEHKEIEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAELLNSKLPKWQETCGDATKVPEKIM
NMIEEIKTPSSTPVSGTPQPSPMIERSNMVGKDYDTLPKYSPKMPPVSSARAYASPLADM
FNNPATIPKTPERLNNHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAPVRS
ISTVNLAEKSNVVIPPPDYLECLSGVAAADRRIDASLKSSTFKPPAPKPEITTPXXXXXX
XXXXXXXGENPFATVKLRPTVTNDRSAPIIR
Download sequence
Identical sequences ENSMEUP00000007121 ENSMEUP00000007121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]