SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007142 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007142
Domain Number 1 Region: 238-501
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-82
Family Nuclear receptor ligand-binding domain 0.000000000184
Further Details:      
 
Domain Number 2 Region: 133-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007142   Gene: ENSMEUG00000007824   Transcript: ENSMEUT00000007842
Sequence length 503
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4154:9620:92350:1 gene:ENSMEUG00000007824 transcript:ENSMEUT00000007842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGKRGDSPTDTHDSFTDIQLEKSSEGIAMVDTEMPFWPTNFGISSVDLSVMDDHSHSFDI
KPFTTVDFSSISTPHYEDIPFTRADPMVPDYKYDLKLQECPSAIKVEPPSPPYYSEKSQL
YNKPHEESSNSLMTIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRI
HKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRAL
AKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHNTPLQEQS
KEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLM
NKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAIKFNALELDDSDLAIFIAVIILS
GDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ
VIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences ENSMEUP00000007142 ENSMEUP00000007142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]