SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007185 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007185
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.92e-71
Family Arfaptin, Rac-binding fragment 0.0000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007185   Gene: ENSMEUG00000007868   Transcript: ENSMEUT00000007890
Sequence length 341
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4160:2596:4877:-1 gene:ENSMEUG00000007868 transcript:ENSMEUT00000007890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEAGRLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSAD
GLIPTGPGRQQPHSATPAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRDTKRKYESILQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTLGRLESAQATFQTHREKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQQQLEQTLQQFNIKLRPPGSEKPSWLEEQ
Download sequence
Identical sequences F7FRA7
XP_001363387.1.35504 ENSMODP00000023176 ENSMEUP00000007185 ENSMODP00000023176 ENSMEUP00000007185 13616.ENSMODP00000023176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]