SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007208 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007208
Domain Number 1 Region: 318-497
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000257
Further Details:      
 
Domain Number 2 Region: 12-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.8e-48
Family BAR domain 0.0056
Further Details:      
 
Domain Number 3 Region: 193-294
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-16
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007208   Gene: ENSMEUG00000007878   Transcript: ENSMEUT00000007915
Sequence length 730
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1062:11959:155082:-1 gene:ENSMEUG00000007878 transcript:ENSMEUT00000007915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSDFLNFATMPLSESFKEFAELLNEVENERMMMVQNASDLLIKPLENFRKEQIGLTKER
KKKFEKDSERFYSLLDRHLHLSSKKKESQLQEADLQLDRERHNFFESSLDYVYQIQEVQE
TKKFNIVEPVLAFLHSLFISNNLTVELTQDFLPYKQQLQLSLQNTRNHFSSTREEMEELK
KRMKEAPQMCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKSLTMTPMEQKPGAK
QGPVDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWMEAMDGKEPIY
HSPITKQEEMELNDVGFKFVRKCTNAVEAKGITTEGVYRTVGSNIQVQKLLNAFFDPKCP
GDVDLQNSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVSAAKSENLDYRLGAIHALVY
KLPNKNRDMLELLIRHLVNVCEHSRENLMSPSNMGVIFGPTLMRAQEDTVAAMMNIKFQN
IVVEILIEHFDKIYSGPPEDNAAPPVPPPRVTARRHKPITISKRPLRERTVFYTSSVEEN
EHETLNGPITDSLESSRPLPHHKLPLQRSGEPEPGRKSPLRPSSDGKLEPCPEVDVGKLV
SRLQDGGPKPPAKVANGLMMGPGPARVPSLHVRPAPRPLAHSKEGDYDSFSKVRSPGDKP
AITRPPVRPPDPPCRVVVPQKPEPKPEPVAGGAPETMASVVACRTRFFETASRKTGSSSS
PQGRLAGDES
Download sequence
Identical sequences ENSMEUP00000007208 ENSMEUP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]