SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007316 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007316
Domain Number 1 Region: 182-313
Classification Level Classification E-value
Superfamily C-type lectin-like 6.07e-34
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.81e-25
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 3 Region: 1376-1480
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-25
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1490-1623
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-25
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 1073-1187
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-24
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 6 Region: 323-456
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-20
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 927-1003
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000199
Family C-type lectin domain 0.0094
Further Details:      
 
Domain Number 8 Region: 1248-1326
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000007
Family C-type lectin domain 0.0091
Further Details:      
 
Domain Number 9 Region: 504-559
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000367
Family C-type lectin domain 0.0045
Further Details:      
 
Domain Number 10 Region: 783-847
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000464
Family C-type lectin domain 0.033
Further Details:      
 
Domain Number 11 Region: 675-726
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000525
Family C-type lectin domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007316   Gene: ENSMEUG00000007976   Transcript: ENSMEUT00000008035
Sequence length 1682
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_510:267:87029:-1 gene:ENSMEUG00000007976 transcript:ENSMEUT00000008035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGPFTIRHENTGKCLKTVNGLVVAVDCKKTNDMQWKWVSQHRLFHVESQMCLGIDIAKPK
DSLKMFSCDSNAMLWWKCEYGTLYSASQYRLTLKDRQVTANVNSSDTWKKGDSDEYLCDQ
PYHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XDGCEDDWEKNEQFGSCYQLNTQAALNWKEAFISCQNQGANLVSISSAAELIHLKDKEGI
PKMFWIGLNQLDSSKGWEWSDHTPLNFLNWNPEIPSSPTVGGSSCVIMNAVSGQWHSFPC
EALFPYVCKKQLNETSKSSDVWTYLETLCDPGWLPNNGFCYLLVNKTGSWDEANAECISX
XXXXXXXXXXXXXXXXXXXXXXXXTKEEIWTGLKNNDTPALFKWSDGTEVTLTYWDQNEP
DIPYNKTPNCVCYSGKLGHWRVQSCEKKLKYVCKKTGKTINETRLDKDCPQEEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXFEQEFLNSMIKKYSKGGRKSFWTGLRDEDSRGEYKWA
NVNGTKPVVTYVNWNSLEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDQRWIWVGLNKRSPDSQGSWQWSDSTPVSTVVISNEFQEDYDIRDC
AALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTPKTPEWFNPDRAGIH
GPPVVIEDSEYWFVDTHLNYEEAVYCASNQSSLASLKSLTALNAIRDKIANLSDNQQKWW
IKTFDSLSTYHDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXCFLKIKPKLYTFSEAKEACHTYGGTLPSVLSQS
EQDFITYLLPDLGNNVWIGLLRSCEQMSKWTDDNKLVYSNFHALLQGREQRIPIDXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQENHMLPNTSTILKYRDYSY
KIILKAMTWYEALEECQKEAMQLVSITDPYQQAFLTVQTVLHNSSLWIGLSSQDDELNYD
WSDGKHFSFSRWSENSAQLEDCVILDTDGFWKASGCKSIQPGAICYTSRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKAHALSIRDEREN
DFVREQLLYFNYMASWVLLGITYDDDSLKWYDKTALSYVNWKTGRPTIKSKQFYAGLNTD
GFWDIYLYNNVKEALYFHQRSILACKIEMXXXXXXXXXXXXXXXXXXXXXXXXXXTKFTW
YEALKECSQNGGSLASVHDKKSQLFLEDLAKRDGFPLWTGLSSHDGSDSTFEWSDGSTFD
YTPWKEQNSTGNCVVLEPKGIWRHEKCNSVMDGAICYKPKKAKPQALQKYSSRCPSPKGI
PWIPFGDSCYTFDKALHSFLEARQLCSELDSAANIVTIKNEDENMFVSRMIREHNYVTMR
VWLGLSQHPNDDSWSWLDGSVSEYVWGNESTIGGCSVLLASSETWTKVKCDQGHGRAVCK
VPMGRNYRAVAIAIAVMTFLALVCVLMWRLYQKKRLHWAGFSLVRFDHGVNEDEIMLPSF
RD
Download sequence
Identical sequences ENSMEUP00000007316 ENSMEUP00000007316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]