SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007445 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007445
Domain Number 1 Region: 285-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-31
Family Nuclear receptor ligand-binding domain 0.00000822
Further Details:      
 
Domain Number 2 Region: 50-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.85e-30
Family Nuclear receptor 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007445
Domain Number - Region: 446-476
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0239
Family Nuclear receptor ligand-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007445   Gene: ENSMEUG00000008146   Transcript: ENSMEUT00000008171
Sequence length 533
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9981:15125:37969:-1 gene:ENSMEUG00000008146 transcript:ENSMEUT00000008171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEEAVELWAAVLLTESRPPSTASAKVPFSLPQPTGDANQGGSVMRTQIEVIPCKICGDKS
SGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQSCPIDRTSRNRCQHCRLQKCLALGMSR
DAVKFGRMSKKQRDSLHAEVQKQLQQQRQQVATPPPAGTRGADTPAYTLALPSGQLPLGS
SPDLPESSACPPALLSTPGPGPSYPTSLAKMGLTGAVYSRGYSPDRAKAEVGRAFYGLGS
QLSPDRCELHIGEPRHLVFGEPSQGRDLYSSPSFRLELPNASLTEIEHLIQNVCKSYQET
CQLRLEDLQRQRSNIFSREEVINYQRKSMWEMWERCAHRLTEAIQYVVEFAKRLAGFMEL
CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGVDLFRALXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRPWLQEKRKVEQLQHNLELAFHHLLCKTHRQGILA
XXXXXXXXXXXXXXXXXXXXXXXXXXXIVQAAFPPLYKELFSTENEPPGMLSD
Download sequence
Identical sequences ENSMEUP00000007445 ENSMEUP00000007445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]