SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007447 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007447
Domain Number 1 Region: 31-153
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-29
Family C-type lectin domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 253-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 306-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 199-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000082
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 381-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 497-558
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007447   Gene: ENSMEUG00000008147   Transcript: ENSMEUT00000008173
Sequence length 792
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8226:737:30169:-1 gene:ENSMEUG00000008147 transcript:ENSMEUT00000008173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYYLEAFRNGRFQRTIFWTALMSALIAQIQVGAWTYHYSTEAYSWNFSRRFCQAFYTDLV
AIQNKNEIAYLNEFLPFYPEYYWIGIRKINNVWTWVGTNKTLTKEAENWAENEPNNKRND
QDCVEIYIKRTSSAGKWNDEPCLKKKRALCYKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXTECKELGLIPGNMRMTCSHPLGNFSYKSTCNFYCMEGHRLNGASMLECLAS
GEWTAEIPECSVIECPALKNPERGNMNCTKENVYQSSCNFSCEEGFILKGENVVWCTASG
AWTAPVPQCEAVRCLDLETPNGGAINYVHSHAVFVYNSTCKFSCQPGYRVLGFETLQCLA
SGQWTASMPTCQXXXXXXXXSPAHGSLNCSSSLPEFQYNSRCSFQCAEGFVLKGAETTEC
DMSGTWTAPAPVCHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXITCKPLLTPEEGKMTCVHPFGDSCYKSTCQFNCNEGFSLIGSD
KLHCTISGHWTADPPRCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPLSIQKALTYFGGAVASVSSLVIGGS
ILGLLRKRFRKK
Download sequence
Identical sequences ENSMEUP00000007447 ENSMEUP00000007447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]