SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007449 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007449
Domain Number 1 Region: 640-806
Classification Level Classification E-value
Superfamily C-type lectin-like 1e-47
Family Endostatin 0.00000255
Further Details:      
 
Domain Number 2 Region: 321-411
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000565
Family Endostatin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007449   Gene: ENSMEUG00000008136   Transcript: ENSMEUT00000008175
Sequence length 812
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9820:6422:91654:1 gene:ENSMEUG00000008136 transcript:ENSMEUT00000008175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDPGEGLPGSPGPSGPPGTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPPGPPGPP
GSPGLPGEPGAEIYIGPPGSPGEDGPSGEPGPPGPDGLPGLNGAVGLPGMKGEKGEKGPN
GPTGEKGDSGKRGLPGPPGKDGVVGEPGPPGLPGPPGPPGASCGMGLGFEXXXXXXXXXX
XXXXXXXXXXXXXGPKGEKGDQGPKGEKGHDGSGLIGPPGPPGPPGPRKDLTTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGPKGPKGDTGFPGLPGEKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXGPKGPPGHKGELGFPGRPGRPGLNGLKGAKGERGVVLLGP
PGLPGPPGPPGPPGAVINIKGTVFPISPRPHCKTPVNPTHPGNSELITFHXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESGNKGIKGEKGDSNGGFFMPGPPG
LPGSPGQMGQKGDSVIGPRGPPGAPGLPGPPGYGAHGPPGPPGPPGPPGPPAILGSXXXX
XXXXXXXXXXXXXXXXXXVTTFGNIESMMQNAHLVIEGTLIYLSESAEFFIRVRNGWKKL
QLGELIPIPADSPPPPAFSSNFQQPLPPPIPASNANYEKPALRLVALNMPFSGDIRADFQ
CFQQAQAAGLLSTYRAFLSSHLQDLFTVVRKADSYSLPIVNLKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPQKVIWHGSNTNGIRLVSNYCEAWRTADVAVTGNASPL
STGRILDQKTYSCANKLIVLCIENSFMTDVRK
Download sequence
Identical sequences ENSMEUP00000007449 ENSMEUP00000007449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]