SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007512 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007512
Domain Number 1 Region: 109-211
Classification Level Classification E-value
Superfamily TPR-like 4.51e-24
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007512
Domain Number - Region: 218-279
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0186
Family BAR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007512   Gene: ENSMEUG00000008228   Transcript: ENSMEUT00000008244
Sequence length 353
Comment pep:novel scaffold:Meug_1.0:Scaffold7189:26031:27118:-1 gene:ENSMEUG00000008228 transcript:ENSMEUT00000008244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSKLRAFVKLCQQDPARLYSEELRFLREWVESLGGRIPSTPRKMRSDDRFKGGEAERK
KWEEYIKKEDVETEESDLELDNEGVIVDDLDCPQEMGDATAEVTDEMIDQANEMKVKGLD
ALHNGEYQKALELFTDAIRLNPCWAILYTLRASIFIELQKPNAAIRDCSKAIDLNPHTAE
PYKWRGKAHRLLGHWEEAGQDLSLSCKLDFDEDANAVLQDIQPRIQRIQEHRRKREQRRE
ERKYRERVERMRKAREEYDKAKQEEEDRRMAAHCSLPIFLGEIPRMRRRMRSIPGKSVLN
EILGDPEILAAMQDEEVMQAQDVARYPETMGRYKNNSKVMNFFSKLSNKFGVR
Download sequence
Identical sequences ENSMEUP00000007512 ENSMEUP00000007512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]