SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007582 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000007582
Domain Number - Region: 147-200
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0131
Family FCH domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007582   Gene: ENSMEUG00000008300   Transcript: ENSMEUT00000008318
Sequence length 219
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2129:11073:17274:1 gene:ENSMEUG00000008300 transcript:ENSMEUT00000008318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQKIFTFPLWGKIAPYWNKAFLTIIVLLIVLFLDAVREVKKYSVSHGLEKSSSSHPSAYE
HVQMKLFRAQRNLYISGFSLFLWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXALEKTGKGDEQMTDAENKKLIENVEKLKTELKKTSDALSKAHNEVTTMKKQ
SESLSKEYDRLLKEHTQLQNFSLWSLGRRTQKSRSIRKE
Download sequence
Identical sequences ENSMEUP00000007582 ENSMEUP00000007582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]