SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007661 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007661
Domain Number 1 Region: 167-306
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-23
Family C-type lectin domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007661   Gene: ENSMEUG00000008385   Transcript: ENSMEUT00000008403
Sequence length 307
Comment pep:novel scaffold:Meug_1.0:Scaffold16061:6068:7985:1 gene:ENSMEUG00000008385 transcript:ENSMEUT00000008403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLLALVPLCWEGQRGLRRKEKESRPDAQAEEQERESLLLKHLQEALELSPFQGPESPTG
TSEGEGPWGEEDKEDTPLTPSPSLAPSPTPEDAISYVLGRLTGLDSGLHQLHVRLYTLDA
RVAELSRGLQLLRKEARDTRETLEALEEAQKQGRRDRGRLEGCLKGLRLGHKCFLLFRDF
QAQSAAHAHCGARGGSLAMPADRAQMEGLTRYLKAALAPYNWPVWLGIHDRRAEGLYLFE
NSQRVSFFAWHRAPLEGAQPNAWPPALGPDQPNGREQENCVAQASDDGSWWDHDCERRFY
YVCEFPQ
Download sequence
Identical sequences ENSMEUP00000007661 ENSMEUP00000007661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]