SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007690 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007690
Domain Number 1 Region: 15-142,185-279
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-37
Family Ras GEF 0.00083
Further Details:      
 
Domain Number 2 Region: 411-534
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007690   Gene: ENSMEUG00000008413   Transcript: ENSMEUT00000008435
Sequence length 541
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4660:791:114758:1 gene:ENSMEUG00000008413 transcript:ENSMEUT00000008435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSSSDSLEGRSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLH
SLMSVVSALQSAPIFRLTKTWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLITLPHVQ
KYLKSVRYIEELQKFVEDDNYKLSLRIEPGSCSPRLVSSKEDLAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXMMCQFSVVESKSATFPSERPRHLLDDSVLEPHS
PGRGQGRGLPLTSSAITNGLSLXXXXXXXXXXXXXXXXXXPTGPCSCALGNSAGVITMEG
PLKRKTLLKEGRKPALSSWSRYWVTLSGSTLLYFGAKSLRGTDRKHYKSTPGKKVSIIGW
MVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRLHAILWHKHLDDACKSNRPQVPTNLMSF
E
Download sequence
Identical sequences ENSMEUP00000007690 ENSMEUP00000007690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]